CJC-1295 (Modified GRF 1-29, no DAC)

Research reagent · CAS 447415-26-1 · Lyophilized vial

Product name	CJC-1295 (Modified GRF 1-29, no DAC)
CAS number	447415-26-1
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (modified)
Molecular formula	C152H252N64O44S
Molecular weight	~3448.9 Da
Form	Lyophilized vial
Storage	Sealed, dry, −20 °C, protect from light
Salt	Stated on lot COA

Presentations

Size	Availability
10 mg	Coming soon	Request quote

Overview

CJC-1295 without DAC is a modified growth-hormone-releasing factor (GRF 1-29) reagent. It incorporates amino-acid substitutions to resist enzymatic degradation while retaining the active 1-29 fragment. The peptide is studied in growth-hormone-signaling models and pituitary-cell assays. The catalog item is a research reagent, not a finished drug product. No dosing, injection, or administration guidance is provided.

Research context

Modified GRF 1-29 receptor-binding assays
Growth-hormone secretion models in pituitary cell culture
Enzyme-resistance and peptide-stability studies
GHRH signaling pathway research
cAMP-mediated signaling in pituitary preparations

Documentation

A supplier Certificate of Analysis (COA) is a starting point. Released lots are verified by an independent U.S. laboratory:

Identity by LC-MS
HPLC purity
Peptide content
Salt composition
Endotoxin
Sterility when offered for sterile in-vitro work
Metals and water when on the panel

Certificates appear here when a lot is verified.

Research use only. Not a drug, pharmacy, or 503A/503B compounding facility. Not for human or veterinary use. This product is not intended to diagnose, treat, cure, or prevent any disease.

Request a quote

Tell us the size, quantity, and your institution. We respond within one business day.

10 mg — Request quote

Opens an email to purchasing@prosperresearchmaterialsllc.com