Sermorelin

Research reagent · CAS 86168-78-7 · Lyophilized vial

Product name	Sermorelin
CAS number	86168-78-7
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (fragment 1-29)
Molecular formula	C149H246N64O44S
Molecular weight	~3357.9 Da
Form	Lyophilized vial
Storage	Sealed, dry, −20 °C, protect from light
Salt	Stated on lot COA

Presentations

Size	Availability
10 mg	Coming soon	Request quote

Overview

Sermorelin is a GHRH(1-29) analog reagent used in growth-hormone-signaling research. It corresponds to the biologically active N-terminal 29-amino-acid fragment of growth-hormone-releasing hormone. The peptide is studied in pituitary-cell response models and endocrine-pathway research. The catalog item is a research reagent, not a finished drug product. No dosing, injection, or administration guidance is provided.

Research context

GHRH receptor activation assays
Pituitary somatotrope response models
Growth-hormone signaling pathway studies
Endocrine-feedback-loop research
cAMP-mediated signaling in pituitary preparations

Documentation

A supplier Certificate of Analysis (COA) is a starting point. Released lots are verified by an independent U.S. laboratory:

Identity by LC-MS
HPLC purity
Peptide content
Salt composition
Endotoxin
Sterility when offered for sterile in-vitro work
Metals and water when on the panel

Certificates appear here when a lot is verified.

Research use only. Not a drug, pharmacy, or 503A/503B compounding facility. Not for human or veterinary use. This product is not intended to diagnose, treat, cure, or prevent any disease.

Request a quote

Tell us the size, quantity, and your institution. We respond within one business day.

10 mg — Request quote

Opens an email to purchasing@prosperresearchmaterialsllc.com