Tesamorelin

Research reagent · CAS 901758-09-6 · Lyophilized vial

Product name	Tesamorelin
CAS number	901758-09-6
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular formula	C221H345N79O66S
Molecular weight	~5135.8 Da
Form	Lyophilized vial
Storage	Sealed, dry, −20 °C, protect from light
Salt	Stated on lot COA

Presentations

Size	Availability
10 mg	Coming soon	Request quote
20 mg	Coming soon	Request quote

Overview

Tesamorelin is a growth-hormone-releasing-hormone (GHRH) analog reagent used in endocrine-signaling research. It is a synthetic peptide that has been studied in models of growth-hormone secretion and pituitary-cell response. We do not sell a finished drug product. The catalog item is supplied as a lyophilized research reagent for in-vitro laboratory use. No dosing, injection, or administration guidance is provided.

Research context

Growth-hormone secretion models in pituitary cell culture
GHRH receptor signaling assays
Endocrine-pathway research
Somatotrope response studies
cAMP-mediated signaling in pituitary preparations

Documentation

A supplier Certificate of Analysis (COA) is a starting point. Released lots are verified by an independent U.S. laboratory:

Identity by LC-MS
HPLC purity
Peptide content
Salt composition
Endotoxin
Sterility when offered for sterile in-vitro work
Metals and water when on the panel

Certificates appear here when a lot is verified.

Research use only. Not a drug, pharmacy, or 503A/503B compounding facility. Not for human or veterinary use. This product is not intended to diagnose, treat, cure, or prevent any disease.

Request a quote

Tell us the size, quantity, and your institution. We respond within one business day.

10 mg — Request quote 20 mg — Request quote

Opens an email to purchasing@prosperresearchmaterialsllc.com